| Brand: | Abnova |
| Reference: | H00006201-M03 |
| Product name: | RPS7 monoclonal antibody (M03), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS7. |
| Clone: | 3G4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 6201 |
| Gene name: | RPS7 |
| Gene alias: | - |
| Gene description: | ribosomal protein S7 |
| Genbank accession: | NM_001011 |
| Immunogen: | RPS7 (NP_001002, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL |
| Protein accession: | NP_001002 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A systems wide mass spectrometric based linear motif screen to identify dominant in-vivo interacting proteins for the ubiquitin ligase MDM2.Nicholson J, Scherl A, Way L, Blackburn EA, Walkinshaw MD, Ball KL, Hupp TR. Cell Signal. 2014 Jun;26(6):1243-57. doi: 10.1016/j.cellsig.2014.02.011. Epub 2014 Feb 28. |