Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CCL14 monoclonal antibody (M04), clone 3B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CCL14 monoclonal antibody (M04), clone 3B12
| Brand: | Abnova |
| Reference: | H00006358-M04 |
| Product name: | CCL14 monoclonal antibody (M04), clone 3B12 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CCL14. |
| Clone: | 3B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 6358 |
| Gene name: | CCL14 |
| Gene alias: | CC-1|CC-3|CKb1|HCC-1|HCC-3|MCIF|NCC-2|NCC2|SCYA14|SCYL2|SY14 |
| Gene description: | chemokine (C-C motif) ligand 14 |
| Genbank accession: | BC045165 |
| Immunogen: | CCL14 (AAH45165, 20 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Protein accession: | AAH45165 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |