Brand: | Abnova |
Reference: | H00005914-M09A |
Product name: | RARA monoclonal antibody (M09A), clone 2C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RARA. |
Clone: | 2C3 |
Isotype: | IgG1 Kappa |
Gene id: | 5914 |
Gene name: | RARA |
Gene alias: | NR1B1|RAR |
Gene description: | retinoic acid receptor, alpha |
Genbank accession: | NM_000964 |
Immunogen: | RARA (NP_000955, 315 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS |
Protein accession: | NP_000955 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RARA monoclonal antibody (M09A), clone 2C3. Western Blot analysis of RARA expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |