| Brand: | Abnova |
| Reference: | H00004760-M01 |
| Product name: | NEUROD1 monoclonal antibody (M01), clone 3H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEUROD1. |
| Clone: | 3H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4760 |
| Gene name: | NEUROD1 |
| Gene alias: | BETA2|BHF-1|NEUROD|bHLHa3 |
| Gene description: | neurogenic differentiation 1 |
| Genbank accession: | BC009046 |
| Immunogen: | NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT |
| Protein accession: | AAH09046 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Neuroendocrine carcinoma of the esophagus: clinicopathologic study of 10 cases and verification of the diagnostic utility of mASH1, NeuroD1, and PGP9.5.Akazawa M, Kawachi H, Kitagaki K, Seki T, Kawaragi S, Yuzawa M, Sekine M, Kobayashi M, Nakajima Y, Kawano T, Eishi Y. Esophagus DOI 10.1007/s10388-014-0444-6 |