| Brand: | Abnova |
| Reference: | H00004724-M03 |
| Product name: | NDUFS4 monoclonal antibody (M03), clone 3F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFS4. |
| Clone: | 3F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4724 |
| Gene name: | NDUFS4 |
| Gene alias: | AQDQ |
| Gene description: | NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) |
| Genbank accession: | NM_002495 |
| Immunogen: | NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK |
| Protein accession: | NP_002486 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NDUFS4 monoclonal antibody (M03), clone 3F11. Western Blot analysis of NDUFS4 expression in human kidney. |
| Applications: | WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |