Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 289,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 289,00 €
Data sheet of CXCR3 monoclonal antibody (M01A), clone 1C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CXCR3 monoclonal antibody (M01A), clone 1C5
| Brand: | Abnova |
| Reference: | H00002833-M01A |
| Product name: | CXCR3 monoclonal antibody (M01A), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CXCR3. |
| Clone: | 1C5 |
| Isotype: | IgM Kappa |
| Gene id: | 2833 |
| Gene name: | CXCR3 |
| Gene alias: | CD182|CD183|CKR-L2|CMKAR3|GPR9|IP10-R|Mig-R|MigR |
| Gene description: | chemokine (C-X-C motif) receptor 3 |
| Genbank accession: | NM_001504 |
| Immunogen: | CXCR3 (NP_001495.1, 1 a.a. ~ 53 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR |
| Protein accession: | NP_001495.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |