Login to display prices
Login to display prices
CHRNE monoclonal antibody (M01), clone 6A2 View larger

CHRNE monoclonal antibody (M01), clone 6A2

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNE monoclonal antibody (M01), clone 6A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CHRNE monoclonal antibody (M01), clone 6A2

Reference: H00001145-M01
Product name: CHRNE monoclonal antibody (M01), clone 6A2
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNE.
Clone: 6A2
Isotype: IgG2a Kappa
Gene id: 1145
Gene name: CHRNE
Gene alias: ACHRE|CMS1D|CMS1E|CMS2A|FCCMS|SCCMS
Gene description: cholinergic receptor, nicotinic, epsilon
Genbank accession: NM_000080
Immunogen: CHRNE (NP_000071, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV
Protein accession: NP_000071
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: