No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00083259-M02 |
| Product name: | PCDH11Y monoclonal antibody (M02), clone 7D12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH11Y. |
| Clone: | 7D12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 83259 |
| Gene name: | PCDH11Y |
| Gene alias: | PCDH-PC|PCDH11X|PCDH22|PCDHY |
| Gene description: | protocadherin 11 Y-linked |
| Genbank accession: | NM_032973 |
| Immunogen: | PCDH11Y (NP_004733, 57 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN |
| Protein accession: | NP_004733 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged PCDH11Y is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |