Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RUNX1T1 monoclonal antibody (M01), clone 5A12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Tr |
More info about RUNX1T1 monoclonal antibody (M01), clone 5A12
| Brand: | Abnova |
| Reference: | H00000862-M01 |
| Product name: | RUNX1T1 monoclonal antibody (M01), clone 5A12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RUNX1T1. |
| Clone: | 5A12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 862 |
| Gene name: | RUNX1T1 |
| Gene alias: | AML1T1|CBFA2T1|CDR|ETO|MGC2796|MTG8|MTG8b|ZMYND2 |
| Gene description: | runt-related transcription factor 1; translocated to, 1 (cyclin D-related) |
| Genbank accession: | NM_004349 |
| Immunogen: | RUNX1T1 (NP_004340, 416 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICG |
| Protein accession: | NP_004340 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RUNX1T1 expression in transfected 293T cell line by RUNX1T1 monoclonal antibody (M01), clone 5A12. Lane 1: RUNX1T1 transfected lysate(67.566 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |