Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
Data sheet of Rhesus monkey IL37/Interleukin 1 Zeta (IL1z) recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Rhesus monkey |
| Host species | Escherichia coli (E. coli) |
More info about Rhesus monkey IL37/Interleukin 1 Zeta (IL1z) recombinant protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4063-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Rhesus monkey IL37/Interleukin 1 Zeta (IL1z) recombinant protein |
| Fragment type: | Full-length |
| Origin species: | Rhesus monkey |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 27.71kDa |
| Purity estimated: | 0.95 |
| Ncbi reference: | XP_011722821.1 |
| Aliases / synonyms: | IL1F7, IL37, FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1H4, IL1RP1, Interleukin 37, Interleukin-1-Related Protein, Interleukin 1 Family, Member 7 |
| Protein sequence (w/o tag): | MGSHHHHHHSGLVPRGSMSNNSTLKMSFVGENSGVKTGSEDWEKDEPQCYSEKDEPQCYSEDPAGSPLEPGPSLPSMNFVHTSPKVKNLNPKKFSIHDQDHKVLVVDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLSCDKDKGQSHPSLQLKKKKLMKLAALKESARRPFIFYRAQVGSRNTLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery lead time in business days: | 2-3 |
| Related products: | - Bifidobacterium longum Amidase Recombinant Protein - Human hCSE Recombinant Protein - Human hTEAD1 Recombinant Protein |