Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Bifidobacterium longum Amidase Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Bifidobacterium longum |
| Host species | Escherichia coli (E. coli) |
More info about Bifidobacterium longum Amidase Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4064-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Bifidobacterium longum Amidase Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Bifidobacterium longum |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 46.76kDa |
| Purity estimated: | 0.7 |
| Ncbi reference: | WP_032737268.1 |
| Protein sequence (w/o tag): | MGCVGGLAFSSAQPAQADTYSDLINAQNQHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEADAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGATSTQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAASAQTAAETAQSERDALDKLRQEGEARRDELSSMIDSLDSQSAKQAAQTVLIASQVDSYNRQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPSVGGQGTSNGDYGNAYATGQCTYWAYERRRQMGIGTPSYLGNGGDWWRNAPSYGLRVDHNPQVGAALSFLPGQDGADGTWGHVAVVEAVYGDGTFQISEMNVGGLWMMNYRTLTNLGQYWFVHGSHHHHHH |
| Delivery lead time in business days: | 2-3 |
| Related products: | - Human hCSE Recombinant Protein - Human hTEAD1 Recombinant Protein - Clostridium chauvoei CCTA-His Recombinant Protein |