Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human TNFSF9/4-1BBL recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
More info about Human TNFSF9/4-1BBL recombinant protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4060-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human TNFSF9/4-1BBL recombinant protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Eukaryotic expression |
| Host species: | Mammalian |
| Molecular weight with tag if any: | 22.64kDa |
| Purity estimated: | 50% |
| Uniprot id: | P41273 |
| Uniprot link: | http://www.uniprot.org/uniprot/P41273 |
| Aliases / synonyms: | 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9 |
| Protein sequence (w/o tag): | MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Form: | Lyophilized |
| Buffer: | PBS, pH 7.5 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |
| Related products: | - Human PAFAH/ LpPLA2/PLA2G7 recombinant protein - Sparus aurata Interleukin 10 (IL10) recombinant protein - Rhesus monkey IL37/Interleukin 1 Zeta (IL1z) recombinant protein |
| Image: |  |