Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human CD137/TNFRSF9/4-1BB recombinant protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Mammalian |
More info about Human CD137/TNFRSF9/4-1BB recombinant protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4059-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human CD137/TNFRSF9/4-1BB recombinant protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Eukaryotic expression |
| Host species: | Mammalian |
| Molecular weight with tag if any: | 20.8kDa |
| Purity estimated: | 60% |
| Uniprot id: | Q07011 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q07011 |
| Aliases / synonyms: | CD137, CDw137, 4-1BB, ILA, Induced By Lymphocyte Activation, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9 |
| Protein sequence (w/o tag): | MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQGSHHHHHH |
| Form: | Lyophilized |
| Buffer: | PBS, pH 7.5 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |
| Related products: | - Human TNFSF9/4-1BBL recombinant protein - Human PAFAH/ LpPLA2/PLA2G7 recombinant protein - Sparus aurata Interleukin 10 (IL10) recombinant protein |