Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human HA-HSP27 Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human HA-HSP27 Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1109-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human HA-HSP27 Recombinant Protein |
| Fragment type: | Full-length |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 25,86 kDa |
| Purity estimated: | >95% |
| Protein accession: | NP_001531.1 |
| Spec:entrez geneid: | 3315 |
| Spec:ncbi gene aliases: | HMN2B, HS.76067, HSP27, HEL-S-102, CMT2F, SRP27, Hsp25, HSP28 |
| Spec:swissprotid: | P04792 |
| Ncbi reference: | NP_001531.1 |
| Uniprot id: | P04792 |
| Uniprot link: | http://www.uniprot.org/uniprot/P04792 |
| Aliases / synonyms: | HA-HSP27, Heat Shock 27kDa Protein 1 / heat shock protein beta-1 |
| Protein sequence (w/o tag): | MAHNHRHKHKLMAYPYDVPDYASLGGHMTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPG YVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGY ISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
| Form: | liquid |
| Buffer: | PBS, imidazole 300mM. PBS only if dialysis |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Drosophila Hh Recombinant Protein - Human HIRA(155-254) Recombinant Protein - Human HSP110de9 Recombinant Protein |