No products
Prices are tax excluded
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P1109-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human HA-HSP27 Recombinant Protein |
Fragment type: | Full-length |
Origin species: | Human |
Expression system: | Prokaryotic expression |
Host species: | Escherichia coli (E. coli) |
Molecular weight with tag if any: | 25,86 kDa |
Purity estimated: | >95% |
Protein accession: | NP_001531.1 |
Spec:entrez geneid: | 3315 |
Spec:ncbi gene aliases: | HMN2B, HS.76067, HSP27, HEL-S-102, CMT2F, SRP27, Hsp25, HSP28 |
Spec:swissprotid: | P04792 |
Ncbi reference: | NP_001531.1 |
Uniprot id: | P04792 |
Uniprot link: | http://www.uniprot.org/uniprot/P04792 |
Aliases / synonyms: | HA-HSP27, Heat Shock 27kDa Protein 1 / heat shock protein beta-1 |
Protein sequence (w/o tag): | MAHNHRHKHKLMAYPYDVPDYASLGGHMTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPG YVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGY ISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Form: | liquid |
Buffer: | PBS, imidazole 300mM. PBS only if dialysis |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | Dry Ice |
Delivery lead time in business days: | 10-25 |
Related products: | - Drosophila Hh Recombinant Protein - Human HIRA(155-254) Recombinant Protein - Human HSP110de9 Recombinant Protein |