Cart 42 Product Products 12 687,59 € (empty)
-
1 x AW-1...259,07 € -
1 x Phospho-AP...259,07 € -
1 x ApoER2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x TBG...554,11 € -
1 x IGFBP1...379,42 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
265,00 € DAP Shipping
12 952,59 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 42 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 12 687,59 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 12 952,59 €
Data sheet of Human HIRA(155-254) Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human HIRA(155-254) Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1111-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human HIRA(155-254) Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 38,26 kDa |
| Purity estimated: | 0.8 |
| Protein accession: | AAH32721.1 |
| Spec:entrez geneid: | 7290 |
| Spec:ncbi gene aliases: | DGCR1, TUPLE1, TUP1 |
| Spec:swissprotid: | P54198 |
| Ncbi reference: | AAH32721.1 |
| Uniprot id: | P54198 |
| Uniprot link: | http://www.uniprot.org/uniprot/P54198 |
| Aliases / synonyms: | HIRA(155-254), HIRA protein |
| Protein sequence (w/o tag): | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPVVAAS ARPAGDSVNKDSMNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVKELRPRD LLESSSDSDEKVPLARAAAS |
| Form: | liquid |
| Buffer: | TrisHC 50mMl, 10mM glutathione reduced pH8 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Human HSP110de9 Recombinant Protein - Human HSP110wt Recombinant Protein - Human UHRF1/ICBP90 tagged Recombinant Protein |