C8orf33 purified MaxPab rabbit polyclonal antibody (D01P) View larger

C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,IF,WB-Tr

More info about C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00065265-D01P
Product name: C8orf33 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human C8orf33 protein.
Gene id: 65265
Gene name: C8orf33
Gene alias: FLJ20989
Gene description: chromosome 8 open reading frame 33
Genbank accession: BC010001.1
Immunogen: C8orf33 (AAH10001.1, 1 a.a. ~ 229 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Protein accession: AAH10001.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00065265-D01P-13-15-1.jpg
Application image note: Western Blot analysis of C8orf33 expression in transfected 293T cell line (H00065265-T02) by C8orf33 MaxPab polyclonal antibody.

Lane 1: C8orf33 transfected lysate(25.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C8orf33 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart