| Brand: | Abnova |
| Reference: | H00005408-A01 |
| Product name: | PNLIPRP2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PNLIPRP2. |
| Gene id: | 5408 |
| Gene name: | PNLIPRP2 |
| Gene alias: | PLRP2 |
| Gene description: | pancreatic lipase-related protein 2 |
| Genbank accession: | NM_005396 |
| Immunogen: | PNLIPRP2 (NP_005387, 333 a.a. ~ 435 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLG |
| Protein accession: | NP_005387 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Discrimination between adenocarcinoma and normal pancreatic ductal fluid by proteomic and glycomic analysis.Porterfield M, Zhao P, Han H, Cunningham J, Aoki K, Von Hoff DD, Demeure MJ, Pierce JM, Tiemeyer M, Wells L. J Proteome Res. 2014 Feb 7;13(2):395-407. |