No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00051144-B01P |
| Product name: | HSD17B12 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HSD17B12 protein. |
| Gene id: | 51144 |
| Gene name: | HSD17B12 |
| Gene alias: | KAR|SDR12C1 |
| Gene description: | hydroxysteroid (17-beta) dehydrogenase 12 |
| Genbank accession: | BC012536.1 |
| Immunogen: | HSD17B12 (AAH12536.1, 1 a.a. ~ 98 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT |
| Protein accession: | AAH12536.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HSD17B12 expression in transfected 293T cell line (H00051144-T01) by HSD17B12 MaxPab polyclonal antibody. Lane 1: HSD17B12 transfected lysate(10.78 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |