| Brand: | Abnova |
| Reference: | H00051125-D01P |
| Product name: | GOLGA7 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GOLGA7 protein. |
| Gene id: | 51125 |
| Gene name: | GOLGA7 |
| Gene alias: | GCP16|GOLGA3AP1|GOLGA7A|HSPC041|MGC21096|MGC4876 |
| Gene description: | golgi autoantigen, golgin subfamily a, 7 |
| Genbank accession: | BC001227 |
| Immunogen: | GOLGA7 (AAH01227.1, 1 a.a. ~ 134 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA |
| Protein accession: | AAH01227.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GOLGA7 expression in transfected 293T cell line () by GOLGA7 MaxPab polyclonal antibody.
Lane 1: GOLGA7 transfected lysate(15.60 KDa).
Lane 2: Non-transfected lysate.
|
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
