METTL9 purified MaxPab mouse polyclonal antibody (B01P) View larger

METTL9 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of METTL9 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about METTL9 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00051108-B01P
Product name: METTL9 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human METTL9 protein.
Gene id: 51108
Gene name: METTL9
Gene alias: CGI-81|DREV|DREV1|FLJ21912|PAP1
Gene description: methyltransferase like 9
Genbank accession: BC000195
Immunogen: METTL9 (AAH00195.1, 1 a.a. ~ 283 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV
Protein accession: AAH00195.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00051108-B01P-13-15-1.jpg
Application image note: Western Blot analysis of METTL9 expression in transfected 293T cell line (H00051108-T01) by METTL9 MaxPab polyclonal antibody.

Lane 1: DREV1 transfected lysate(31.13 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy METTL9 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart