| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00051108-B01P |
| Product name: | METTL9 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human METTL9 protein. |
| Gene id: | 51108 |
| Gene name: | METTL9 |
| Gene alias: | CGI-81|DREV|DREV1|FLJ21912|PAP1 |
| Gene description: | methyltransferase like 9 |
| Genbank accession: | BC000195 |
| Immunogen: | METTL9 (AAH00195.1, 1 a.a. ~ 283 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV |
| Protein accession: | AAH00195.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of METTL9 expression in transfected 293T cell line (H00051108-T01) by METTL9 MaxPab polyclonal antibody. Lane 1: DREV1 transfected lysate(31.13 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |