No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00051101-B01P |
| Product name: | C8orf70 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C8orf70 protein. |
| Gene id: | 51101 |
| Gene name: | FAM164A |
| Gene alias: | C8orf70|CGI-62 |
| Gene description: | family with sequence similarity 164, member A |
| Genbank accession: | ENST00000263849 |
| Immunogen: | C8orf70 (ENSP00000263849, 1 a.a. ~ 325 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL |
| Protein accession: | ENSP00000263849 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of FAM164A expression in transfected 293T cell line (H00051101-T01) by FAM164A MaxPab polyclonal antibody. Lane1:C8orf70 transfected lysate(35.75 KDa). Lane2:Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |