| Brand: | Abnova |
| Reference: | H00023545-A01 |
| Product name: | ATP6V0A2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ATP6V0A2. |
| Gene id: | 23545 |
| Gene name: | ATP6V0A2 |
| Gene alias: | ARCL|ATP6N1D|ATP6a2|J6B7|Stv1|TJ6|TJ6M|TJ6s|Vph1|WSS|a2 |
| Gene description: | ATPase, H+ transporting, lysosomal V0 subunit a2 |
| Genbank accession: | NM_012463 |
| Immunogen: | ATP6V0A2 (NP_036595, 198 a.a. ~ 304 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKK |
| Protein accession: | NP_036595 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ATP6V0A2 polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of ATP6V0A2 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | (Pro)renin receptor is required for prorenin-dependent and -independent regulation of vacuolar H+-ATPase activity in MDCK.C11 collecting duct cells.Lu X, Garrelds IM, Wagner CA, Danser AH, Meima ME. Am J Physiol Renal Physiol. 2013 Aug 1;305(3):F417-25. doi: 10.1152/ajprenal.00037.2013. Epub 2013 May 22. |