No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00023543-M02 |
| Product name: | RBM9 monoclonal antibody (M02), clone 5E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RBM9. |
| Clone: | 5E11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 23543 |
| Gene name: | RBM9 |
| Gene alias: | FOX2|Fox-2|HNRBP2|HRNBP2|RTA|dJ106I20.3|fxh |
| Gene description: | RNA binding motif protein 9 |
| Genbank accession: | BC013115 |
| Immunogen: | RBM9 (AAH13115, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQS |
| Protein accession: | AAH13115 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to RBM9 on A-431 cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |