Brand: | Abnova |
Reference: | H00023523-M02A |
Product name: | CABIN1 monoclonal antibody (M02A), clone 2F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CABIN1. |
Clone: | 2F5 |
Isotype: | IgG2a Kappa |
Gene id: | 23523 |
Gene name: | CABIN1 |
Gene alias: | CAIN|KIAA0330|PPP3IN |
Gene description: | calcineurin binding protein 1 |
Genbank accession: | NM_012295 |
Immunogen: | CABIN1 (NP_036427, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM |
Protein accession: | NP_036427 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |