POFUT1 (Human) Recombinant Protein (Q01) View larger

POFUT1 (Human) Recombinant Protein (Q01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POFUT1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about POFUT1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00023509-Q01
Product name: POFUT1 (Human) Recombinant Protein (Q01)
Product description: Human POFUT1 partial ORF ( NP_758436, 85 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 23509
Gene name: POFUT1
Gene alias: FUT12|KIAA0180|MGC2482|O-FUT|O-Fuc-T|O-FucT-1
Gene description: protein O-fucosyltransferase 1
Genbank accession: NM_172236
Immunogen sequence/protein sequence: VSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR
Protein accession: NP_758436
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00023509-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POFUT1 (Human) Recombinant Protein (Q01) now

Add to cart