No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,WB-Tr |
| Brand: | Abnova |
| Reference: | H00023509-D01P |
| Product name: | POFUT1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human POFUT1 protein. |
| Gene id: | 23509 |
| Gene name: | POFUT1 |
| Gene alias: | FUT12|KIAA0180|MGC2482|O-FUT|O-Fuc-T|O-FucT-1 |
| Gene description: | protein O-fucosyltransferase 1 |
| Genbank accession: | NM_172236 |
| Immunogen: | POFUT1 (NP_758436.1, 1 a.a. ~ 194 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRRENHSCVTLLFPR |
| Protein accession: | NP_758436.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of POFUT1 expression in transfected 293T cell line (H00023509-T02) by POFUT1 MaxPab polyclonal antibody. Lane 1: POFUT1 transfected lysate(22.30 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Downregulated protein O-fucosyl transferase 1 (Pofut1) expression exerts antiproliferative and antiadhesive effects on hepatocytes by inhibiting Notch signalling.Annani-Akollor ME, Wang S, Fan J, Liu L, Padhiar AA, Zhang J. Biomed Pharmacother. 2014 Jul;68(6):785-90. |