Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MACF1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MACF1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00023499-A01 |
| Product name: | MACF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MACF1. |
| Gene id: | 23499 |
| Gene name: | MACF1 |
| Gene alias: | ABP620|ACF7|FLJ45612|FLJ46776|KIAA0465|KIAA1251|MACF|OFC4 |
| Gene description: | microtubule-actin crosslinking factor 1 |
| Genbank accession: | BC007330 |
| Immunogen: | MACF1 (AAH07330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPF |
| Protein accession: | AAH07330 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.45 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative protein and mRNA profiling shows selective post-transcriptional control of protein expression by vasopressin in kidney cells.Khositseth S, Pisitkun T, Slentz DH, Wang G, Hoffert JD, Knepper MA, Yu MJ. Mol Cell Proteomics. 2010 Oct 12. [Epub ahead of print] |