No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00023495-M19 |
| Product name: | TNFRSF13B monoclonal antibody (M19), clone 1D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF13B. |
| Clone: | 1D5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23495 |
| Gene name: | TNFRSF13B |
| Gene alias: | CD267|CVID|FLJ39942|MGC133214|MGC39952|TACI|TNFRSF14B |
| Gene description: | tumor necrosis factor receptor superfamily, member 13B |
| Genbank accession: | NM_012452 |
| Immunogen: | TNFRSF13B (NP_036584.1, 2 a.a. ~ 165 a.a) partial recombinant protein. |
| Immunogen sequence/protein sequence: | SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYS |
| Protein accession: | NP_036584.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (20.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |