Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HEY2 monoclonal antibody (M02), clone 2B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about HEY2 monoclonal antibody (M02), clone 2B10
| Brand: | Abnova |
| Reference: | H00023493-M02 |
| Product name: | HEY2 monoclonal antibody (M02), clone 2B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HEY2. |
| Clone: | 2B10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23493 |
| Gene name: | HEY2 |
| Gene alias: | CHF1|GRIDLOCK|GRL|HERP1|HESR2|HRT2|MGC10720|bHLHb32 |
| Gene description: | hairy/enhancer-of-split related with YRPW motif 2 |
| Genbank accession: | NM_012259 |
| Immunogen: | HEY2 (NP_036391.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKG |
| Protein accession: | NP_036391.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HEY2 monoclonal antibody (M02), clone 2B10. Western Blot analysis of HEY2 expression in human pancreas. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |