Cart 29 Product Products 10 198,08 € (empty)
No products
To be determined Shipping
10 198,08 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 29 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 198,08 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 198,08 €
Data sheet of CBX7 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about CBX7 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00023492-B01P |
| Product name: | CBX7 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CBX7 protein. |
| Gene id: | 23492 |
| Gene name: | CBX7 |
| Gene alias: | - |
| Gene description: | chromobox homolog 7 |
| Genbank accession: | NM_175709.2 |
| Immunogen: | CBX7 (NP_783640.1, 1 a.a. ~ 251 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
| Protein accession: | NP_783640.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CBX7 expression in transfected 293T cell line (H00023492-T02) by CBX7 MaxPab polyclonal antibody. Lane 1: CBX7 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |