Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NIFUN monoclonal antibody (M01), clone 3B8-1C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about NIFUN monoclonal antibody (M01), clone 3B8-1C4
| Brand: | Abnova |
| Reference: | H00023479-M01 |
| Product name: | NIFUN monoclonal antibody (M01), clone 3B8-1C4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NIFUN. |
| Clone: | 3B8-1C4 |
| Isotype: | IgG1 kappa |
| Gene id: | 23479 |
| Gene name: | ISCU |
| Gene alias: | 2310020H20Rik|HML|ISU2|MGC74517|NIFU|NIFUN|hnifU |
| Gene description: | iron-sulfur cluster scaffold homolog (E. coli) |
| Genbank accession: | BC011906 |
| Immunogen: | NIFUN (AAH11906, 26 a.a. ~ 167 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
| Protein accession: | AAH11906 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to NIFUN on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Metabolic adaptation to chronic hypoxia in cardiac mitochondria.Heather LC, Cole MA, Tan JJ, Ambrose LJ, Pope S, Abd-Jamil AH, Carter EE, Dodd MS, Yeoh KK, Schofield CJ, Clarke K. Basic Res Cardiol. 2012 May;107(3):268. Epub 2012 Apr 27. |