No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023475-M01 |
Product name: | QPRT monoclonal antibody (M01), clone 5D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant QPRT. |
Clone: | 5D11 |
Isotype: | IgG1 Kappa |
Gene id: | 23475 |
Gene name: | QPRT |
Gene alias: | QPRTase |
Gene description: | quinolinate phosphoribosyltransferase |
Genbank accession: | NM_014298 |
Immunogen: | QPRT (NP_055113, 198 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH |
Protein accession: | NP_055113 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to QPRT on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Anti-apoptotic quinolinate phosphoribosyltransferase (QPRT) is a target gene of Wilms tumor gene 1 (WT1) protein in leukemic cells.Muniz-Lino MA, Rodriguez-Vazquez M, Chavez-Munguia B, Ortiz-Garcia JZ, Gonzalez-Lopez L, Hernandez-Hernandez FC, Liceaga-Escalera C, Garcia-Munoz A, Rodriguez MA. Biochem Biophys Res Commun. 2017 Jan 22;482(4):802-807. Epub 2016 Nov 23. |