| Brand: | Abnova |
| Reference: | H00023475-M01 |
| Product name: | QPRT monoclonal antibody (M01), clone 5D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant QPRT. |
| Clone: | 5D11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 23475 |
| Gene name: | QPRT |
| Gene alias: | QPRTase |
| Gene description: | quinolinate phosphoribosyltransferase |
| Genbank accession: | NM_014298 |
| Immunogen: | QPRT (NP_055113, 198 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH |
| Protein accession: | NP_055113 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to QPRT on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Anti-apoptotic quinolinate phosphoribosyltransferase (QPRT) is a target gene of Wilms tumor gene 1 (WT1) protein in leukemic cells.Muniz-Lino MA, Rodriguez-Vazquez M, Chavez-Munguia B, Ortiz-Garcia JZ, Gonzalez-Lopez L, Hernandez-Hernandez FC, Liceaga-Escalera C, Garcia-Munoz A, Rodriguez MA. Biochem Biophys Res Commun. 2017 Jan 22;482(4):802-807. Epub 2016 Nov 23. |