View larger

SF3B3 (Human) Recombinant Protein (Q01)

Reference:

Condition: New product

Data sheet of SF3B3 (Human) Recombinant Protein (Q01)

Brand:	Abnova
Reference:	H00023450-Q01
Product name:	SF3B3 (Human) Recombinant Protein (Q01)
Product description:	Human SF3B3 partial ORF ( NP_036558.3, 819 a.a. - 929 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	23450
Gene name:	SF3B3
Gene alias:	KIAA0017\|RSE1\|SAP130\|SF3b130\|STAF130
Gene description:	splicing factor 3b, subunit 3, 130kDa
Genbank accession:	NM_012426
Immunogen sequence/protein sequence:	MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYK
Protein accession:	NP_036558.3
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Human albumin attenuates excessive innate immunity via inhibition of microglial Mincle/Syk signaling in subarachnoid hemorrhage.Xie Y, Guo H, Wang L, Xu L, Zhang X, Yu L, Liu Q, Li Y, Zhao N, Zhao N, Ye R, Liu X Brain Behav Immun. 2016 Nov 11. [Epub ahead of print]