| Brand: | Abnova |
| Reference: | H00023435-A01 |
| Product name: | TARDBP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant TARDBP. |
| Gene id: | 23435 |
| Gene name: | TARDBP |
| Gene alias: | ALS10|TDP-43 |
| Gene description: | TAR DNA binding protein |
| Genbank accession: | NM_007375.3 |
| Immunogen: | TARDBP (NP_031401.1, 1 a.a. ~ 260 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA |
| Protein accession: | NP_031401.1 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TARDBP polyclonal antibody (A01), Lot # Abnova060510QCS1 Western Blot analysis of TARDBP expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A yeast TDP-43 proteinopathy model: Exploring the molecular determinants of TDP-43 aggregation and cellular toxicity.Johnson BS, McCaffery JM, Lindquist S, Gitler AD. Proc Natl Acad Sci U S A. 2008 Apr 29;105(17):6439-44. Epub 2008 Apr 23. |