RHOQ monoclonal antibody (M03), clone 2C1 View larger

RHOQ monoclonal antibody (M03), clone 2C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOQ monoclonal antibody (M03), clone 2C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about RHOQ monoclonal antibody (M03), clone 2C1

Brand: Abnova
Reference: H00023433-M03
Product name: RHOQ monoclonal antibody (M03), clone 2C1
Product description: Mouse monoclonal antibody raised against a partial recombinant RHOQ.
Clone: 2C1
Isotype: IgG2b Kappa
Gene id: 23433
Gene name: RHOQ
Gene alias: ARHQ|RASL7A|TC10|TC10A
Gene description: ras homolog gene family, member Q
Genbank accession: NM_012249
Immunogen: RHOQ (NP_036381, 106 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLI
Protein accession: NP_036381
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023433-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RHOQ is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy RHOQ monoclonal antibody (M03), clone 2C1 now

Add to cart