| Brand: | Abnova |
| Reference: | H00023428-M01 |
| Product name: | SLC7A8 monoclonal antibody (M01), clone 3F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC7A8. |
| Clone: | 3F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23428 |
| Gene name: | SLC7A8 |
| Gene alias: | LAT2|LPI-PC1 |
| Gene description: | solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 |
| Genbank accession: | NM_012244 |
| Immunogen: | SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP |
| Protein accession: | NP_036376.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC7A8 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | PICK1 is Essential for Insulin Production and the Maintenance of Glucose Homeostasis.Li J, Mao Z, Huang J, Xia J. Mol Biol Cell. 2018 Jan 3. [Epub ahead of print] |