| Brand: | Abnova |
| Reference: | H00023421-M01 |
| Product name: | ITGB3BP monoclonal antibody (M01), clone 3F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITGB3BP. |
| Clone: | 3F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23421 |
| Gene name: | ITGB3BP |
| Gene alias: | CENP-R|CENPR|HSU37139|NRIF3|TAP20 |
| Gene description: | integrin beta 3 binding protein (beta3-endonexin) |
| Genbank accession: | BC014385 |
| Immunogen: | ITGB3BP (AAH14385, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTK |
| Protein accession: | AAH14385 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ITGB3BP monoclonal antibody (M01), clone 3F6 Western Blot analysis of ITGB3BP expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |