Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CRB1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CRB1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00023418-A01 |
| Product name: | CRB1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CRB1. |
| Gene id: | 23418 |
| Gene name: | CRB1 |
| Gene alias: | LCA8|RP12 |
| Gene description: | crumbs homolog 1 (Drosophila) |
| Genbank accession: | NM_012076 |
| Immunogen: | CRB1 (NP_036208, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC |
| Protein accession: | NP_036208 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Overexpression of Human CRB1 or Related Isoforms, CRB2 and CRB3, Does Not Regulate the Human Presenilin Complex in Culture Cells.Pardossi-Piquard R, Chen F, Silva-Gagliardi NF, Szego M, McInnes R, McGlade CJ, George-Hyslop PS, Fraser PE. Biochemistry. 2007 Dec 4;46(48):13704-13710. Epub 2007 Nov 8. |