No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00023411-M01 |
Product name: | SIRT1 monoclonal antibody (M01), clone 7B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SIRT1. |
Clone: | 7B7 |
Isotype: | IgG1 Kappa |
Gene id: | 23411 |
Gene name: | SIRT1 |
Gene alias: | SIR2L1 |
Gene description: | sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) |
Genbank accession: | BC012499 |
Immunogen: | SIRT1 (AAH12499, 456 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS |
Protein accession: | AAH12499 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | SIRT1 monoclonal antibody (M01), clone 7B7 Western Blot analysis of SIRT1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Simvastatin inhibits Cyr61 expression in rheumatoid arthritis synovial fibroblasts through the regulation of SIRT1/FoxO3a signaling.Kok SH, Lin LD, Hou KL, Hong CY, Chang CC, Hsiao M, Wang JH, Lai EH, Lin SK. Arthritis Rheum. 2012 Dec 12. doi: 10.1002/art.37807. |