| Brand: | Abnova |
| Reference: | H00023409-M03 |
| Product name: | SIRT4 monoclonal antibody (M03), clone 1C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIRT4. |
| Clone: | 1C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23409 |
| Gene name: | SIRT4 |
| Gene alias: | MGC130046|MGC130047|MGC57437|SIR2L4 |
| Gene description: | sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) |
| Genbank accession: | NM_012240 |
| Immunogen: | SIRT4 (NP_036372.1, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC |
| Protein accession: | NP_036372.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SIRT4 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |