SIRT4 purified MaxPab mouse polyclonal antibody (B01P) View larger

SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SIRT4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00023409-B01P
Product name: SIRT4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SIRT4 protein.
Gene id: 23409
Gene name: SIRT4
Gene alias: MGC130046|MGC130047|MGC57437|SIR2L4
Gene description: sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae)
Genbank accession: NM_012240.1
Immunogen: SIRT4 (NP_036372.1, 1 a.a. ~ 314 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC
Protein accession: NP_036372.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023409-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SIRT4 expression in transfected 293T cell line (H00023409-T01) by SIRT4 MaxPab polyclonal antibody.

Lane 1: SIRT4 transfected lysate(34.54 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SIRT4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart