Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 385,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 385,00 €
Data sheet of BRRN1 monoclonal antibody (M01), clone 1C9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about BRRN1 monoclonal antibody (M01), clone 1C9
| Brand: | Abnova |
| Reference: | H00023397-M01 |
| Product name: | BRRN1 monoclonal antibody (M01), clone 1C9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BRRN1. |
| Clone: | 1C9 |
| Isotype: | IgG1 kappa |
| Gene id: | 23397 |
| Gene name: | NCAPH |
| Gene alias: | BRRN1|CAP-H|HCAP-H |
| Gene description: | non-SMC condensin I complex, subunit H |
| Genbank accession: | BC024211 |
| Immunogen: | BRRN1 (AAH24211, 645 a.a. ~ 741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KKLKQSMWSLLTALSGKEADAEANHREAGKEAALAEVADEKMLSGLTKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQGD |
| Protein accession: | AAH24211 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | BRRN1 monoclonal antibody (M01), clone 1C9 Western Blot analysis of BRRN1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |