Brand: | Abnova |
Reference: | H00023394-M01 |
Product name: | ADNP monoclonal antibody (M01), clone 6B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADNP. |
Clone: | 6B8 |
Isotype: | IgG3 Kappa |
Gene id: | 23394 |
Gene name: | ADNP |
Gene alias: | ADNP1|KIAA0784 |
Gene description: | activity-dependent neuroprotector homeobox |
Genbank accession: | NM_015339 |
Immunogen: | ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA |
Protein accession: | NP_056154 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |