Cart 7 Product Products 2 785,00 € (empty)
No products
To be determined Shipping
2 785,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 785,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 785,00 €
Data sheet of MED13L monoclonal antibody (M01), clone 4H2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about MED13L monoclonal antibody (M01), clone 4H2
| Brand: | Abnova |
| Reference: | H00023389-M01 |
| Product name: | MED13L monoclonal antibody (M01), clone 4H2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MED13L. |
| Clone: | 4H2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23389 |
| Gene name: | MED13L |
| Gene alias: | DKFZp781D0112|FLJ21627|KIAA1025|PROSIT240|THRAP2|TRAP240L |
| Gene description: | mediator complex subunit 13-like |
| Genbank accession: | NM_015335 |
| Immunogen: | MED13L (NP_056150, 1186 a.a. ~ 1285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY |
| Protein accession: | NP_056150 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MED13L is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |