NCSTN monoclonal antibody (M01), clone 1E8 View larger

NCSTN monoclonal antibody (M01), clone 1E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCSTN monoclonal antibody (M01), clone 1E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NCSTN monoclonal antibody (M01), clone 1E8

Brand: Abnova
Reference: H00023385-M01
Product name: NCSTN monoclonal antibody (M01), clone 1E8
Product description: Mouse monoclonal antibody raised against a partial recombinant NCSTN.
Clone: 1E8
Isotype: IgG2a Kappa
Gene id: 23385
Gene name: NCSTN
Gene alias: APH2|KIAA0253
Gene description: nicastrin
Genbank accession: BC047621
Immunogen: NCSTN (AAH47621, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFS
Protein accession: AAH47621
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023385-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023385-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NCSTN is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NCSTN monoclonal antibody (M01), clone 1E8 now

Add to cart