Brand: | Abnova |
Reference: | H00023373-M01 |
Product name: | CRTC1 monoclonal antibody (M01), clone 8F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CRTC1. |
Clone: | 8F9 |
Isotype: | IgG2a Kappa |
Gene id: | 23373 |
Gene name: | CRTC1 |
Gene alias: | FLJ14027|KIAA0616|MECT1|TORC1|WAMTP1 |
Gene description: | CREB regulated transcription coactivator 1 |
Genbank accession: | NM_015321 |
Immunogen: | CRTC1 (NP_056136.1, 553 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDELKIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL |
Protein accession: | NP_056136.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CRTC1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |