Brand: | Abnova |
Reference: | H00023369-M16 |
Product name: | PUM2 monoclonal antibody (M16), clone 4G12 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PUM2. |
Clone: | 4G12 |
Isotype: | IgG2a Kappa |
Gene id: | 23369 |
Gene name: | PUM2 |
Gene alias: | FLJ36528|KIAA0235|MGC138251|MGC138253|PUMH2|PUML2 |
Gene description: | pumilio homolog 2 (Drosophila) |
Genbank accession: | NM_015317 |
Immunogen: | PUM2 (NP_056132, 106 a.a. ~ 205 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLDSRFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQASPTEVVERLGPNTNPSEGLGPLPN |
Protein accession: | NP_056132 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |