PUM2 monoclonal antibody (M02), clone 1C8 View larger

PUM2 monoclonal antibody (M02), clone 1C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PUM2 monoclonal antibody (M02), clone 1C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PUM2 monoclonal antibody (M02), clone 1C8

Brand: Abnova
Reference: H00023369-M02
Product name: PUM2 monoclonal antibody (M02), clone 1C8
Product description: Mouse monoclonal antibody raised against a partial recombinant PUM2.
Clone: 1C8
Isotype: IgG1 Kappa
Gene id: 23369
Gene name: PUM2
Gene alias: FLJ36528|KIAA0235|MGC138251|MGC138253|PUMH2|PUML2
Gene description: pumilio homolog 2 (Drosophila)
Genbank accession: NM_015317
Immunogen: PUM2 (NP_056132, 701 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DIMPSGRSRLLEDFRNNRFPNLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFEFGSLDQKLALATR
Protein accession: NP_056132
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00023369-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00023369-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PUM2 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PUM2 monoclonal antibody (M02), clone 1C8 now

Add to cart