Cart 35 Product Products 6 964,23 € (empty)
-
1 x FAM102A-fa...113,40 € -
-
-
1 x C7orf49-ch...113,40 € -
1 x KIAA1191-K...121,50 € -
1 x SFXN4-side...121,50 € -
1 x SMYD1-SET...121,50 € -
1 x KIF26A-kin...113,40 € -
1 x RPL35-ribo...113,40 € -
1 x HLA-F-majo...121,50 € -
1 x HMGN3-high...113,40 € -
1 x HMGA1-high...113,40 € -
1 x NOSTRIN-ni...121,50 € -
1 x ZNF614-zin...113,40 € -
1 x NTSR2-neur...121,50 € -
1 x ABHD7-abhy...121,50 € -
-
1 x ANKRD22-an...113,40 € -
1 x CCDC51-coi...121,50 € -
1 x TSC22D4-TS...121,50 € -
1 x MKRN3-mako...113,40 € -
1 x MS4A3-memb...113,40 € -
1 x ASPA-aspar...121,50 € -
1 x COL20A1-co...113,40 € -
1 x APP-amyloi...121,50 € -
1 x NSUN5-NOL1...121,50 € -
1 x NMU-neurom...113,40 € -
1 x SLC38A1-so...121,50 € -
-
-
-
-
1 x ASS1-argin...121,50 € -
-
No products
To be determined Shipping
6 964,23 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 35 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 964,23 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 964,23 €
Data sheet of PPP1R13B (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Applications | AP,Array,ELISA,WB-Re |
More info about PPP1R13B (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00023368-Q01 |
| Product name: | PPP1R13B (Human) Recombinant Protein (Q01) |
| Product description: | Human PPP1R13B partial ORF (NP_056131.2, 1 a.a. - 90 a.a.) recombinant protein with GST tag at N-terminal. |
| Gene id: | 23368 |
| Gene name: | PPP1R13B |
| Gene alias: | ASPP1|KIAA0771|p53BP2-like|p85 |
| Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 13B |
| Genbank accession: | NM_015316.2 |
| Immunogen sequence/protein sequence: | MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWGPRREEVKFFLRHEDSPTENS |
| Protein accession: | NP_056131.2 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |