| Brand: | Abnova |
| Reference: | H00023368-M04 |
| Product name: | PPP1R13B monoclonal antibody (M04), clone 6H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP1R13B. |
| Clone: | 6H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 23368 |
| Gene name: | PPP1R13B |
| Gene alias: | ASPP1|KIAA0771|p53BP2-like|p85 |
| Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 13B |
| Genbank accession: | NM_015316.2 |
| Immunogen: | PPP1R13B (NP_056131.2, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWGPRREEVKFFLRHEDSPTENS |
| Protein accession: | NP_056131.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PPP1R13B is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |